![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
![]() | Superfamily d.33.1: SecB-like [54611] (3 families) ![]() |
![]() | Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein) automatically mapped to Pfam PF02556 |
![]() | Protein Bacterial protein-export protein SecB [54613] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102884] (1 PDB entry) |
![]() | Domain d1qynd_: 1qyn D: [96600] |
PDB Entry: 1qyn (more details), 2.35 Å
SCOPe Domain Sequences for d1qynd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qynd_ d.33.1.1 (D:) Bacterial protein-export protein SecB {Escherichia coli [TaxId: 562]} mtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvlrvtvtasl geetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsrgtfpqlnl apvnfdalfmnylqqq
Timeline for d1qynd_: