Lineage for d1qynb_ (1qyn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943085Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
    automatically mapped to Pfam PF02556
  6. 2943086Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 2943087Species Escherichia coli [TaxId:562] [102884] (1 PDB entry)
  8. 2943089Domain d1qynb_: 1qyn B: [96598]

Details for d1qynb_

PDB Entry: 1qyn (more details), 2.35 Å

PDB Description: crystal structure of secb from escherichia coli
PDB Compounds: (B:) protein-export protein secb

SCOPe Domain Sequences for d1qynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qynb_ d.33.1.1 (B:) Bacterial protein-export protein SecB {Escherichia coli [TaxId: 562]}
mtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvlrvtvtasl
geetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsrgtfpqlnl
apvnfdalfmnyl

SCOPe Domain Coordinates for d1qynb_:

Click to download the PDB-style file with coordinates for d1qynb_.
(The format of our PDB-style files is described here.)

Timeline for d1qynb_: