Lineage for d1qyna_ (1qyn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943085Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
    automatically mapped to Pfam PF02556
  6. 2943086Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 2943087Species Escherichia coli [TaxId:562] [102884] (1 PDB entry)
  8. 2943088Domain d1qyna_: 1qyn A: [96597]

Details for d1qyna_

PDB Entry: 1qyn (more details), 2.35 Å

PDB Description: crystal structure of secb from escherichia coli
PDB Compounds: (A:) protein-export protein secb

SCOPe Domain Sequences for d1qyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyna_ d.33.1.1 (A:) Bacterial protein-export protein SecB {Escherichia coli [TaxId: 562]}
mtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvlrvtvtasl
geetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsrgtfpqlnl
apvnfdalfmnylq

SCOPe Domain Coordinates for d1qyna_:

Click to download the PDB-style file with coordinates for d1qyna_.
(The format of our PDB-style files is described here.)

Timeline for d1qyna_: