Lineage for d1qyma_ (1qym A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612405Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species)
  7. 2612408Species Human (Homo sapiens) [TaxId:9606] [102882] (3 PDB entries)
    Uniprot O75832
  8. 2612410Domain d1qyma_: 1qym A: [96596]

Details for d1qyma_

PDB Entry: 1qym (more details), 2.8 Å

PDB Description: X-ray structure of human gankyrin
PDB Compounds: (A:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d1qyma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyma_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]}
cvsnlmvcnlaysgkleelkesiladkslatrtdqdsrtalhwacsaghteivefllqlg
vpvndkddagwsplhiaasagrdeivkallgkgaqvnavnqngctplhyaasknrheiav
mllegganpdakdhyeatamhraaakgnlkmihillyykastniqdtegntplhlacdee
rveeakllvsqgasiyienkeektplqvakgglglilkrmveg

SCOPe Domain Coordinates for d1qyma_:

Click to download the PDB-style file with coordinates for d1qyma_.
(The format of our PDB-style files is described here.)

Timeline for d1qyma_: