Lineage for d1qyia1 (1qyi A:1-378)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527344Family c.108.1.13: Hypothetical protein MW1667 (SA1546) [102310] (1 protein)
    the insertion subdomain is multi-helical
  6. 2527345Protein Hypothetical protein MW1667 (SA1546) [102311] (1 species)
  7. 2527346Species Staphylococcus aureus [TaxId:1280] [102312] (1 PDB entry)
  8. 2527347Domain d1qyia1: 1qyi A:1-378 [96595]
    Other proteins in same PDB: d1qyia2
    structural genomics; NESG target ZR25

Details for d1qyia1

PDB Entry: 1qyi (more details), 2.5 Å

PDB Description: x-ray structure of q8nw41 northeast structural genomics consortium target zr25.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1qyia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyia1 c.108.1.13 (A:1-378) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]}
mkkilfdvdgvflseercfdvsaltvyellmdkcylglhshidwetltdndiqdirnrif
qkdkilnklkslglnsnwdmlfivfsihlidilkklshdeieafmyqdepvelklqnist
nladcfnlneqlplqfldnvkvgknniyaaleefattelhvsdatlfslkgalwtlaqev
yqewylgsklyedvekkiarttfktgyiyqeiilrpvdevkvllndlkgagfelgiatgr
pytetvvpfenlgllpyfeadfiatasdvleaenmypqarplgkpnpfsyiaalygnnrd
kyesyinkqdnivnkddvfivgdsladllsaqkigatfigtltglkgkdaageleahhad
yvinhlgelrgvldnlle

SCOPe Domain Coordinates for d1qyia1:

Click to download the PDB-style file with coordinates for d1qyia1.
(The format of our PDB-style files is described here.)

Timeline for d1qyia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qyia2