Lineage for d1qyia_ (1qyi A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404561Family c.108.1.13: Hypothetical protein MW1667 (SA1546) [102310] (1 protein)
    the insertion subdomain is multi-helical
  6. 404562Protein Hypothetical protein MW1667 (SA1546) [102311] (1 species)
  7. 404563Species Staphylococcus aureus [TaxId:1280] [102312] (1 PDB entry)
  8. 404564Domain d1qyia_: 1qyi A: [96595]
    structural genomics; NESG target ZR25

Details for d1qyia_

PDB Entry: 1qyi (more details), 2.5 Å

PDB Description: x-ray structure of q8nw41 northeast structural genomics consortium target zr25.

SCOP Domain Sequences for d1qyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus}
mkkilfdvdgvflseercfdvsaltvyellmdkcylglhshidwetltdndiqdirnrif
qkdkilnklkslglnsnwdmlfivfsihlidilkklshdeieafmyqdepvelklqnist
nladcfnlneqlplqfldnvkvgknniyaaleefattelhvsdatlfslkgalwtlaqev
yqewylgsklyedvekkiarttfktgyiyqeiilrpvdevkvllndlkgagfelgiatgr
pytetvvpfenlgllpyfeadfiatasdvleaenmypqarplgkpnpfsyiaalygnnrd
kyesyinkqdnivnkddvfivgdsladllsaqkigatfigtltglkgkdaageleahhad
yvinhlgelrgvldnllehh

SCOP Domain Coordinates for d1qyia_:

Click to download the PDB-style file with coordinates for d1qyia_.
(The format of our PDB-style files is described here.)

Timeline for d1qyia_: