Lineage for d1qygl2 (1qyg L:108-213)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 549872Domain d1qygl2: 1qyg L:108-213 [96592]
    Other proteins in same PDB: d1qygh1, d1qygh2, d1qygl1
    part of anti-cocaine Fab M82G2
    complexed with bcg

Details for d1qygl2

PDB Entry: 1qyg (more details), 1.81 Å

PDB Description: anti-cocaine antibody m82g2 complexed with benzoylecgonine

SCOP Domain Sequences for d1qygl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qygl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypqditvswkidgaerssgvlnswtdqd
ssdstysmsstltltkdeyerhssytceathktstspitksfnrge

SCOP Domain Coordinates for d1qygl2:

Click to download the PDB-style file with coordinates for d1qygl2.
(The format of our PDB-style files is described here.)

Timeline for d1qygl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qygl1