Lineage for d1qygh1 (1qyg H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510705Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (57 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1510716Domain d1qygh1: 1qyg H:1-113 [96589]
    Other proteins in same PDB: d1qygh2, d1qygl1, d1qygl2
    part of anti-cocaine Fab M82G2
    complexed with bcg

Details for d1qygh1

PDB Entry: 1qyg (more details), 1.81 Å

PDB Description: anti-cocaine antibody m82g2 complexed with benzoylecgonine
PDB Compounds: (H:) Fab M82G2, Heavy chain

SCOPe Domain Sequences for d1qygh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qygh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
a

SCOPe Domain Coordinates for d1qygh1:

Click to download the PDB-style file with coordinates for d1qygh1.
(The format of our PDB-style files is described here.)

Timeline for d1qygh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qygh2