SCOP 1.67: Domain d1qydb_: 1qyd B:

Lineage for d1qydb_ (1qyd B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (40 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Pinoresinol-lariciresinol reductase [102142] (1 species)

7. Species Giant arborvitae (Thuja plicata) [TaxId:3316] [102143] (1 PDB entry)

8. Domain d1qydb_: 1qyd B: [96584]

Details for d1qydb_

PDB Entry: 1qyd, 2.5 Å

PDB Description: Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases

SCOP Domain Sequences for d1qydb_:

Sequence; same for both SEQRES and ATOM records:

>d1qydb_ c.2.1.2 (B:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata)}
dkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgaklie
aslddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmdp
dimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprdk
vliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerlse
qnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypevk
yvtmdsyleryv

Timeline for d1qydb_:

• d1qydb_ is new in SCOP 1.67
  
• d1qydb_ appears in SCOP 1.69
  
• d1qydb_ appears in the current release, SCOPe 2.08