SCOP 1.67: Domain d1qyca_: 1qyc A:

Lineage for d1qyca_ (1qyc A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (40 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Phenylcoumaran benzylic ether reductase [102140] (1 species)

7. Species Loblolly pine (Pinus taeda) [TaxId:3352] [102141] (1 PDB entry)

8. Domain d1qyca_: 1qyc A: [96581]

Details for d1qyca_

PDB Entry: 1qyc, 2.2 Å

PDB Description: Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases

SCOP Domain Sequences for d1qyca_:

Sequence; same for both SEQRES and ATOM records:

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda)}
gsrsrilligatgyigrhvakasldlghptfllvrestassnsekaqllesfkasganiv
hgsiddhaslveavknvdvvistvgslqiesqvniikaikevgtvkrffpsefgndvdnv
havepaksvfevkakvrraieaegipytyvssncfagyflrslaqagltapprdkvvilg
dgnarvvfvkeedigtftikavddprtlnktlylrlpantlslnelvalwekkidktlek
ayvpeeevlkliadtpfpanisiaishsifvkgdqtnfeigpagveasqlypdvkyttvd
eylsnfv

Timeline for d1qyca_:

• d1qyca_ is new in SCOP 1.67
  
• d1qyca_ appears in SCOP 1.69
  
• d1qyca_ appears in the current release, SCOPe 2.08