SCOPe 2.03: Domain d1qyba1: 1qyb A:2-147

Lineage for d1qyba1 (1qyb A:2-147)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
   Uniprot P24931

8. Domain d1qyba1: 1qyb A:2-147 [96579]
   Other proteins in same PDB: d1qyba2
   complexed with fe, so4, zn

Details for d1qyba1

PDB Entry: 1qyb, 1.75 Å

PDB Description: X-ray crystal structure of Desulfovibrio vulgaris rubrerythrin with zinc substituted into the [Fe(SCys)4] site and alternative diiron site structures

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1qyba1:

Sequence; same for both SEQRES and ATOM records:

>d1qyba1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

Timeline for d1qyba1:

• d1qyba1 first appeared in SCOP 1.67
  
• d1qyba1 appears in SCOPe 2.02
  
• d1qyba1 appears in SCOPe 2.04
  
• d1qyba1 appears in the current release, SCOPe 2.08