Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1qyba1 (1qyb A:2-147)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
    Uniprot P24931
  8. Domain d1qyba1: 1qyb A:2-147 [96579]
    Other proteins in same PDB: d1qyba2
    complexed with fe, so4, zn

Details for d1qyba1

PDB Entry: 1qyb (more details)
PDB Description: x-ray crystal structure of desulfovibrio vulgaris rubrerythr zinc substituted into the [fe(scys)4] site and alternative site structures
PDB Compounds: (A:) rubrerythrin

SCOP Domain Sequences for d1qyba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyba1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

SCOP Domain Coordinates for d1qyba1:

Click to download the PDB-style file with coordinates for d1qyba1.
(The format of our PDB-style files is described here.)

Timeline for d1qyba1:

d1qyba1 appears in SCOP 1.75A


d1qyba1
(click for larger image)


d1qyba1 in context of chain
Domains from same chain:
d1qyba2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu