Lineage for d1qy5a_ (1qy5 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667396Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1667397Protein HSP90 [55876] (3 species)
  7. 1667438Species Dog (Canis familiaris) [TaxId:9615] [103225] (22 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 1667441Domain d1qy5a_: 1qy5 A: [96573]
    complexed with m2m, nec

Details for d1qy5a_

PDB Entry: 1qy5 (more details), 1.75 Å

PDB Description: crystal structure of the n-domain of the er hsp90 chaperone grp94 in complex with the specific ligand neca
PDB Compounds: (A:) Endoplasmin

SCOPe Domain Sequences for d1qy5a_:

Sequence, based on SEQRES records: (download)

>d1qy5a_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
keeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeekedsddeaa
veeeeeekkpktkkvektvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1qy5a_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
keeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOPe Domain Coordinates for d1qy5a_:

Click to download the PDB-style file with coordinates for d1qy5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qy5a_: