![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (20 families) ![]() |
![]() | Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein) |
![]() | Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species) Type II phosphoglucose isomerase |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (6 PDB entries) |
![]() | Domain d1qy4a_: 1qy4 A: [96571] |
PDB Entry: 1qy4 (more details), 1.8 Å
SCOP Domain Sequences for d1qy4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qy4a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk vvdnprw
Timeline for d1qy4a_: