Lineage for d1qxxa_ (1qxx A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616111Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 616112Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) (S)
  5. 616119Family d.212.1.2: TonB [64326] (1 protein)
    isolated domain can form different segment-swapped dimers depending on the fragment length
  6. 616120Protein TonB [64327] (1 species)
  7. 616121Species Escherichia coli [TaxId:562] [64328] (3 PDB entries)
  8. 616126Domain d1qxxa_: 1qxx A: [96564]
    forms segment-swapped dimer with a single coiled antiparallel beta-sheet

Details for d1qxxa_

PDB Entry: 1qxx (more details), 2.7 Å

PDB Description: crystal structure of the c-terminal domain of tonb

SCOP Domain Sequences for d1qxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxxa_ d.212.1.2 (A:) TonB {Escherichia coli}
paraqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsg
ivvnilfkingtteiq

SCOP Domain Coordinates for d1qxxa_:

Click to download the PDB-style file with coordinates for d1qxxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qxxa_: