Lineage for d1qxwa_ (1qxw A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872162Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 872163Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 872164Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 872219Protein Methionine aminopeptidase [55924] (5 species)
  7. 872292Species Staphylococcus aureus [TaxId:1280] [103236] (3 PDB entries)
  8. 872294Domain d1qxwa_: 1qxw A: [96563]
    complexed with act, co, m1c

Details for d1qxwa_

PDB Entry: 1qxw (more details), 1.67 Å

PDB Description: Crystal structure of Staphyloccocus aureus in complex with an aminoketone inhibitor 54135.
PDB Compounds: (A:) methionyl aminopeptidase

SCOP Domain Sequences for d1qxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxwa_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]}
mivkteeelqalkeigyicakvrntmqaatkpgittkeldniakelfeeygaisapihde
nfpgqtcisvneevahgipskrviregdlvnidvsalkngyyadtgisfvvgesddpmkq
kvcdvatmafenaiakvkpgtklsnigkavhntarqndlkviknltghgvglslheapah
vlnyfdpkdktlltegmvlaiepfissnasfvtegknewafetsdksfvaqiehtvivtk
dgpilttki

SCOP Domain Coordinates for d1qxwa_:

Click to download the PDB-style file with coordinates for d1qxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qxwa_: