Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Methionine aminopeptidase [55924] (7 species) |
Species Staphylococcus aureus [TaxId:1280] [103236] (3 PDB entries) |
Domain d1qxwa_: 1qxw A: [96563] complexed with act, co, m1c |
PDB Entry: 1qxw (more details), 1.67 Å
SCOPe Domain Sequences for d1qxwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxwa_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} mivkteeelqalkeigyicakvrntmqaatkpgittkeldniakelfeeygaisapihde nfpgqtcisvneevahgipskrviregdlvnidvsalkngyyadtgisfvvgesddpmkq kvcdvatmafenaiakvkpgtklsnigkavhntarqndlkviknltghgvglslheapah vlnyfdpkdktlltegmvlaiepfissnasfvtegknewafetsdksfvaqiehtvivtk dgpilttki
Timeline for d1qxwa_: