Lineage for d1qxwa_ (1qxw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974694Species Staphylococcus aureus [TaxId:1280] [103236] (3 PDB entries)
  8. 2974696Domain d1qxwa_: 1qxw A: [96563]
    complexed with act, co, m1c

Details for d1qxwa_

PDB Entry: 1qxw (more details), 1.67 Å

PDB Description: Crystal structure of Staphyloccocus aureus in complex with an aminoketone inhibitor 54135.
PDB Compounds: (A:) methionyl aminopeptidase

SCOPe Domain Sequences for d1qxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxwa_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]}
mivkteeelqalkeigyicakvrntmqaatkpgittkeldniakelfeeygaisapihde
nfpgqtcisvneevahgipskrviregdlvnidvsalkngyyadtgisfvvgesddpmkq
kvcdvatmafenaiakvkpgtklsnigkavhntarqndlkviknltghgvglslheapah
vlnyfdpkdktlltegmvlaiepfissnasfvtegknewafetsdksfvaqiehtvivtk
dgpilttki

SCOPe Domain Coordinates for d1qxwa_:

Click to download the PDB-style file with coordinates for d1qxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qxwa_: