Lineage for d1qxsd2 (1qxs D:165-333)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1916010Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)
  8. 1916030Domain d1qxsd2: 1qxs D:165-333 [96561]
    Other proteins in same PDB: d1qxsa1, d1qxsb1, d1qxsc1, d1qxsd1
    complexed with nad, s70

Details for d1qxsd2

PDB Entry: 1qxs (more details), 2.75 Å

PDB Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid
PDB Compounds: (D:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1qxsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxsd2 d.81.1.1 (D:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOPe Domain Coordinates for d1qxsd2:

Click to download the PDB-style file with coordinates for d1qxsd2.
(The format of our PDB-style files is described here.)

Timeline for d1qxsd2: