SCOPe 2.05: Domain d1qxsd2: 1qxs D:165-333

Lineage for d1qxsd2 (1qxs D:165-333)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)

8. Domain d1qxsd2: 1qxs D:165-333 [96561]
   Other proteins in same PDB: d1qxsa1, d1qxsb1, d1qxsc1, d1qxsd1
   complexed with nad, s70

Details for d1qxsd2

PDB Entry: 1qxs, 2.75 Å

PDB Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid

PDB Compounds: (D:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1qxsd2:

Sequence; same for both SEQRES and ATOM records:

>d1qxsd2 d.81.1.1 (D:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

Timeline for d1qxsd2:

• d1qxsd2 first appeared in SCOP 1.67
  
• d1qxsd2 appears in SCOPe 2.04
  
• d1qxsd2 appears in SCOPe 2.06
  
• d1qxsd2 appears in the current release, SCOPe 2.08