SCOPe 2.06: Domain d1qxsd1: 1qxs D:1-164,D:334-359

Lineage for d1qxsd1 (1qxs D:1-164,D:334-359)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries)

8. Domain d1qxsd1: 1qxs D:1-164,D:334-359 [96560]
   Other proteins in same PDB: d1qxsa2, d1qxsb2, d1qxsc2, d1qxsd2
   complexed with nad, s70

Details for d1qxsd1

PDB Entry: 1qxs, 2.75 Å

PDB Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid

PDB Compounds: (D:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1qxsd1:

Sequence; same for both SEQRES and ATOM records:

>d1qxsd1 c.2.1.3 (D:1-164,D:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

Timeline for d1qxsd1:

• d1qxsd1 first appeared in SCOP 1.67
  
• d1qxsd1 appears in SCOPe 2.05
  
• d1qxsd1 appears in SCOPe 2.07
  
• d1qxsd1 appears in the current release, SCOPe 2.08