| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
| Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries) |
| Domain d1qxsc1: 1qxs C:1-164,C:334-359 [96558] Other proteins in same PDB: d1qxsa2, d1qxsb2, d1qxsc2, d1qxsd2 complexed with nad, s70 |
PDB Entry: 1qxs (more details), 2.75 Å
SCOPe Domain Sequences for d1qxsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxsc1 c.2.1.3 (C:1-164,C:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl
Timeline for d1qxsc1: