Class b: All beta proteins [48724] (165 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (20 families) |
Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein) |
Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species) Type II phosphoglucose isomerase |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (6 PDB entries) |
Domain d1qxrb_: 1qxr B: [96553] complexed with ni, pa5 |
PDB Entry: 1qxr (more details), 1.7 Å
SCOP Domain Sequences for d1qxrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxrb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk vvdnprw
Timeline for d1qxrb_: