SCOP 1.73: Domain d1qxrb_: 1qxr B:

Lineage for d1qxrb_ (1qxr B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (6 PDB entries)

8. Domain d1qxrb_: 1qxr B: [96553]
   complexed with ni, pa5

Details for d1qxrb_

PDB Entry: 1qxr, 1.7 Å

PDB Description: Crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with 5-phosphoarabinonate

PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOP Domain Sequences for d1qxrb_:

Sequence; same for both SEQRES and ATOM records:

>d1qxrb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

Timeline for d1qxrb_:

• d1qxrb_ first appeared in SCOP 1.67
  
• d1qxrb_ appears in SCOP 1.71
  
• d1qxrb_ appears in SCOP 1.75
  
• d1qxrb_ appears in the current release, SCOPe 2.08