Lineage for d1qxrb_ (1qxr B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470566Superfamily b.82.1: RmlC-like cupins [51182] (13 families) (S)
  5. 470748Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)
  6. 470749Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 470750Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (4 PDB entries)
  8. 470752Domain d1qxrb_: 1qxr B: [96553]

Details for d1qxrb_

PDB Entry: 1qxr (more details), 1.7 Å

PDB Description: Crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with 5-phosphoarabinonate

SCOP Domain Sequences for d1qxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxrb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

SCOP Domain Coordinates for d1qxrb_:

Click to download the PDB-style file with coordinates for d1qxrb_.
(The format of our PDB-style files is described here.)

Timeline for d1qxrb_: