SCOP 1.67: Domain d1qxra_: 1qxr A:

Lineage for d1qxra_ (1qxr A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (12 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (4 PDB entries)

8. Domain d1qxra_: 1qxr A: [96552]

Details for d1qxra_

PDB Entry: 1qxr, 1.7 Å

PDB Description: Crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with 5-phosphoarabinonate

SCOP Domain Sequences for d1qxra_:

Sequence; same for both SEQRES and ATOM records:

>d1qxra_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

Timeline for d1qxra_:

• d1qxra_ is new in SCOP 1.67
  
• d1qxra_ appears in SCOP 1.69
  
• d1qxra_ appears in the current release, SCOPe 2.08