Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (12 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) |
Protein Calpain large subunit, catalytic domain (domain II) [54041] (3 species) includes the N-terminal 'sequence' domain I |
Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (4 PDB entries) |
Domain d1qxpb4: 1qxp B:2-355 [96550] Other proteins in same PDB: d1qxpa1, d1qxpa2, d1qxpa3, d1qxpb1, d1qxpb2, d1qxpb3 mu-like isoform with the large and small subunits fused in a single chain mutant |
PDB Entry: 1qxp (more details), 2.8 Å
SCOP Domain Sequences for d1qxpb4:
Sequence, based on SEQRES records: (download)
>d1qxpb4 d.3.1.3 (B:2-355) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type} agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpafppvshslgfk elgpnssktygikwkrptellsnpqfivdgatrtdicqgalgdswllaaiasltlnetil hrvvpygqsfqegyagifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsall ekayakvngsyealsggctseafedftggvtewydlqkapsdlyqiilkalergsllgcs inisdirdleaitfknlvrghaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdns yewnkvdpyereqlrvkmedgefwmsfrdfireftkleicnltpdalksrtlrn
>d1qxpb4 d.3.1.3 (B:2-355) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type} agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpafppvshslgfk elgpnssktygikwkrptellsnpqfivdgatrtdicqgalgdswllaaiasltlnetil hrvvpygqsfqegyagifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsall ekayakvngsyealsggctseafedftggvtewydlqkapsdlyqiilkalergsllgcs inknlvghaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsewndpyereqlrvkme dgefwmsfrdfireftkleicnltpdalksrrn
Timeline for d1qxpb4:
View in 3D Domains from other chains: (mouse over for more information) d1qxpa1, d1qxpa2, d1qxpa3, d1qxpa4 |