Lineage for d1qxpb4 (1qxp B:2-355)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155026Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2155027Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2155045Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
    Uniprot P97571 33-353
  8. 2155057Domain d1qxpb4: 1qxp B:2-355 [96550]
    Other proteins in same PDB: d1qxpa1, d1qxpa2, d1qxpa3, d1qxpb1, d1qxpb2, d1qxpb3
    mu-like isoform with the large and small subunits fused in a single chain

Details for d1qxpb4

PDB Entry: 1qxp (more details), 2.8 Å

PDB Description: crystal structure of a mu-like calpain
PDB Compounds: (B:) mu-like calpain

SCOPe Domain Sequences for d1qxpb4:

Sequence, based on SEQRES records: (download)

>d1qxpb4 d.3.1.3 (B:2-355) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpafppvshslgfk
elgpnssktygikwkrptellsnpqfivdgatrtdicqgalgdswllaaiasltlnetil
hrvvpygqsfqegyagifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsall
ekayakvngsyealsggctseafedftggvtewydlqkapsdlyqiilkalergsllgcs
inisdirdleaitfknlvrghaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdns
yewnkvdpyereqlrvkmedgefwmsfrdfireftkleicnltpdalksrtlrn

Sequence, based on observed residues (ATOM records): (download)

>d1qxpb4 d.3.1.3 (B:2-355) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpafppvshslgfk
elgpnssktygikwkrptellsnpqfivdgatrtdicqgalgdswllaaiasltlnetil
hrvvpygqsfqegyagifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsall
ekayakvngsyealsggctseafedftggvtewydlqkapsdlyqiilkalergsllgcs
inknlvghaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsewndpyereqlrvkme
dgefwmsfrdfireftkleicnltpdalksrrn

SCOPe Domain Coordinates for d1qxpb4:

Click to download the PDB-style file with coordinates for d1qxpb4.
(The format of our PDB-style files is described here.)

Timeline for d1qxpb4: