Lineage for d1qxpb3 (1qxp B:356-514)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038898Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2038899Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (2 families) (S)
    automatically mapped to Pfam PF01067
  5. 2038900Family b.14.1.1: Calpain large subunit, middle domain (domain III) [49759] (1 protein)
  6. 2038901Protein Calpain large subunit, middle domain (domain III) [49760] (3 species)
  7. 2038908Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [101574] (1 PDB entry)
  8. 2038910Domain d1qxpb3: 1qxp B:356-514 [96549]
    Other proteins in same PDB: d1qxpa1, d1qxpa2, d1qxpa4, d1qxpb1, d1qxpb2, d1qxpb4
    mu-like isoform with the large and small subunits fused in a single chain

Details for d1qxpb3

PDB Entry: 1qxp (more details), 2.8 Å

PDB Description: crystal structure of a mu-like calpain
PDB Compounds: (B:) mu-like calpain

SCOPe Domain Sequences for d1qxpb3:

Sequence, based on SEQRES records: (download)

>d1qxpb3 b.14.1.1 (B:356-514) Calpain large subunit, middle domain (domain III) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
wnttfyegtwrrgstaggcrnypatfwvnpqfkirleevddaddydsresgcsfllalmq
khrrrerrfgrdmetigfavyqvprelagqpvhlkrdfflanasraqsehfinlrevsnr
irlppgeyivvpstfepnkegdfllrffsekkagtqeld

Sequence, based on observed residues (ATOM records): (download)

>d1qxpb3 b.14.1.1 (B:356-514) Calpain large subunit, middle domain (domain III) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
wnttfyegtwrrgstaggcrnypatfwvnpqfkirleevddaddydsresgcsfllalmq
khrfgrdmetigfavyqvprelagpvhlkrdfflanasraqsehfinlrevsnrirlppg
eyivvpstfepnkegdfllrffsekkagtqeld

SCOPe Domain Coordinates for d1qxpb3:

Click to download the PDB-style file with coordinates for d1qxpb3.
(The format of our PDB-style files is described here.)

Timeline for d1qxpb3: