Class a: All alpha proteins [46456] (258 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) |
Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species) |
Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [101186] (1 PDB entry) |
Domain d1qxpb2: 1qxp B:515-702 [96548] Other proteins in same PDB: d1qxpa1, d1qxpa3, d1qxpa4, d1qxpb1, d1qxpb3, d1qxpb4 mu-like isoform with the large and small subunits fused in a single chain mutant |
PDB Entry: 1qxp (more details), 2.8 Å
SCOP Domain Sequences for d1qxpb2:
Sequence, based on SEQRES records: (download)
>d1qxpb2 a.39.1.8 (B:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} dqiqanlpdekvlseeeiddnfktlfsklagddmeisvkelqtilnriiskhkdlrtngf slescrsmvnlmdrdgngklglvefnilwnrirnyltifrkfdldksgsmsayemrmaie aagfklpcqlhqvivarfaddeliidfdnfvrclvrleilfkifkqldpentgtiqldli swlsfsvl
>d1qxpb2 a.39.1.8 (B:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} dqiqanlpdekvktlfisvkelqtilnrtngfslescrsmvnlmdlglvefnilwnrirn yltifrkfdldksgsmsayemrmaieaagfklpcqlhqvivarfaddeliidfdnfvrcl vrleilfkifkqldpentgtiqldliswlsfsvl
Timeline for d1qxpb2:
View in 3D Domains from other chains: (mouse over for more information) d1qxpa1, d1qxpa2, d1qxpa3, d1qxpa4 |