Lineage for d1qxpb1 (1qxp B:710-893)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997611Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1997625Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 1997642Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries)
  8. 1997654Domain d1qxpb1: 1qxp B:710-893 [96547]
    Other proteins in same PDB: d1qxpa2, d1qxpa3, d1qxpa4, d1qxpb2, d1qxpb3, d1qxpb4
    mu-like isoform with the large and small subunits fused in a single chain

Details for d1qxpb1

PDB Entry: 1qxp (more details), 2.8 Å

PDB Description: crystal structure of a mu-like calpain
PDB Compounds: (B:) mu-like calpain

SCOPe Domain Sequences for d1qxpb1:

Sequence, based on SEQRES records: (download)

>d1qxpb1 a.39.1.8 (B:710-893) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mhysnieaneseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
rsmvavmdsdttgklgfeefkylwnnikkwqgiykrfetdrsgtigsnelpgafeaagfh
lnqhiysmiirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlql
tmys

Sequence, based on observed residues (ATOM records): (download)

>d1qxpb1 a.39.1.8 (B:710-893) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mhysnneseerqfrklfvqlmevsatelmfgidtcrsmvavmdsdttgklgfeefkylwn
nikkwqgirfetdrsgpgafeaagfhlnqhiysmiirsdetgnmdfdnfisclvrldamf
rafrsldkngtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1qxpb1:

Click to download the PDB-style file with coordinates for d1qxpb1.
(The format of our PDB-style files is described here.)

Timeline for d1qxpb1: