Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) automatically mapped to Pfam PF00648 |
Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species) includes the N-terminal 'sequence' domain I |
Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries) Uniprot P97571 33-353 |
Domain d1qxpa4: 1qxp A:2-355 [96546] Other proteins in same PDB: d1qxpa1, d1qxpa2, d1qxpa3, d1qxpb1, d1qxpb2, d1qxpb3 mu-like isoform with the large and small subunits fused in a single chain |
PDB Entry: 1qxp (more details), 2.8 Å
SCOPe Domain Sequences for d1qxpa4:
Sequence, based on SEQRES records: (download)
>d1qxpa4 d.3.1.3 (A:2-355) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]} agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpafppvshslgfk elgpnssktygikwkrptellsnpqfivdgatrtdicqgalgdswllaaiasltlnetil hrvvpygqsfqegyagifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsall ekayakvngsyealsggctseafedftggvtewydlqkapsdlyqiilkalergsllgcs inisdirdleaitfknlvrghaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdns yewnkvdpyereqlrvkmedgefwmsfrdfireftkleicnltpdalksrtlrn
>d1qxpa4 d.3.1.3 (A:2-355) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]} agiamklakdreaaeglgsheraikylnqdyetlrnecleagalfqdpafppvshslgfk elgpnssktygikwkrptellsnpqfivdgatrtdicqgalgdswllaaiasltlnetil hrvvpygqsfqegyagifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsall ekayakvngsyealsggctseafedftggvtewydlqkapsdlyqiilkalergsllgcs initfknlhaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsnsyewnkvdpyereq lrvkmedgefwmsfrdfireftkleicnltplksrtlrn
Timeline for d1qxpa4:
View in 3D Domains from other chains: (mouse over for more information) d1qxpb1, d1qxpb2, d1qxpb3, d1qxpb4 |