Lineage for d1qxpa2 (1qxp A:515-702)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995514Family a.39.1.8: Penta-EF-hand proteins [63550] (7 protein domains)
  6. 1995518Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species)
  7. 1995525Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [101186] (1 PDB entry)
  8. 1995526Domain d1qxpa2: 1qxp A:515-702 [96544]
    Other proteins in same PDB: d1qxpa1, d1qxpa3, d1qxpa4, d1qxpb1, d1qxpb3, d1qxpb4
    mu-like isoform with the large and small subunits fused in a single chain

Details for d1qxpa2

PDB Entry: 1qxp (more details), 2.8 Å

PDB Description: crystal structure of a mu-like calpain
PDB Compounds: (A:) mu-like calpain

SCOPe Domain Sequences for d1qxpa2:

Sequence, based on SEQRES records: (download)

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
dqiqanlpdekvlseeeiddnfktlfsklagddmeisvkelqtilnriiskhkdlrtngf
slescrsmvnlmdrdgngklglvefnilwnrirnyltifrkfdldksgsmsayemrmaie
aagfklpcqlhqvivarfaddeliidfdnfvrclvrleilfkifkqldpentgtiqldli
swlsfsvl

Sequence, based on observed residues (ATOM records): (download)

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
dqiqanlpsklagddmeisvkelqtilnrtngfslescrsmvnlmdrngklglvefnilw
nrirnyltifrkfdldksgsmsayemrmaieaagfklpcqlhqvivarfaddeliidfdn
fvrclvrleilfkifkqldpentgtiqldliswlsfsvl

SCOPe Domain Coordinates for d1qxpa2:

Click to download the PDB-style file with coordinates for d1qxpa2.
(The format of our PDB-style files is described here.)

Timeline for d1qxpa2: