Lineage for d1qxna_ (1qxn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852306Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1852307Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 1852385Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins)
  6. 1852386Protein Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) [102425] (1 species)
  7. 1852387Species Wolinella succinogenes [TaxId:844] [102426] (1 PDB entry)
  8. 1852388Domain d1qxna_: 1qxn A: [96537]
    complexed with ps5

Details for d1qxna_

PDB Entry: 1qxn (more details)

PDB Description: solution structure of the 30 kda polysulfide-sulfur transferase homodimer from wolinella succinogenes
PDB Compounds: (A:) sulfide dehydrogenase

SCOPe Domain Sequences for d1qxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]}
admgekfdatfkaqvkaakadmvmlspkdaykllqenpditlidvrdpdelkamgkpdvk
nykhmsrgklepllaksgldpekpvvvfcktaaraalagktlreygfktiynseggmdkw
leeglpsldrshhhhhh

SCOPe Domain Coordinates for d1qxna_:

Click to download the PDB-style file with coordinates for d1qxna_.
(The format of our PDB-style files is described here.)

Timeline for d1qxna_: