Lineage for d1qxna_ (1qxn A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395764Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 395765Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) (S)
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 395813Family c.46.1.3: Single-domain sulfurtransferase [69509] (2 proteins)
  6. 395814Protein Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) [102425] (1 species)
  7. 395815Species Wolinella succinogenes [TaxId:844] [102426] (1 PDB entry)
  8. 395816Domain d1qxna_: 1qxn A: [96537]

Details for d1qxna_

PDB Entry: 1qxn (more details)

PDB Description: solution structure of the 30 kda polysulfide-sulfur transferase homodimer from wolinella succinogenes

SCOP Domain Sequences for d1qxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes}
admgekfdatfkaqvkaakadmvmlspkdaykllqenpditlidvrdpdelkamgkpdvk
nykhmsrgklepllaksgldpekpvvvfcktaaraalagktlreygfktiynseggmdkw
leeglpsldrshhhhhh

SCOP Domain Coordinates for d1qxna_:

Click to download the PDB-style file with coordinates for d1qxna_.
(The format of our PDB-style files is described here.)

Timeline for d1qxna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qxnb_