Lineage for d1qxma1 (1qxm A:4-148)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375486Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 375487Family b.42.2.1: Ricin B-like [50371] (3 proteins)
  6. 375488Protein Hemagglutinin component Ha1 [101784] (1 species)
  7. 375489Species Clostridium botulinum D phage [TaxId:29342] [101785] (1 PDB entry)
  8. 375490Domain d1qxma1: 1qxm A:4-148 [96533]

Details for d1qxma1

PDB Entry: 1qxm (more details), 1.7 Å

PDB Description: crystal structure of a hemagglutinin component (ha1) from type c clostridium botulinum

SCOP Domain Sequences for d1qxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage}
tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
lmvstqtsssnqffkfsnciyealn

SCOP Domain Coordinates for d1qxma1:

Click to download the PDB-style file with coordinates for d1qxma1.
(The format of our PDB-style files is described here.)

Timeline for d1qxma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qxma2