Lineage for d1qxjb_ (1qxj B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677479Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)
  6. 677480Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 677481Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (6 PDB entries)
  8. 677487Domain d1qxjb_: 1qxj B: [96531]
    complexed with ni

Details for d1qxjb_

PDB Entry: 1qxj (more details), 1.8 Å

PDB Description: Crystal structure of native phosphoglucose isomerase from Pyrococcus furiosus
PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOP Domain Sequences for d1qxjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxjb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

SCOP Domain Coordinates for d1qxjb_:

Click to download the PDB-style file with coordinates for d1qxjb_.
(The format of our PDB-style files is described here.)

Timeline for d1qxjb_: