Lineage for d1qxja_ (1qxj A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1558340Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1558598Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
    automatically mapped to Pfam PF06560
  6. 1558599Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 1558600Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries)
    Uniprot P83194
  8. 1558605Domain d1qxja_: 1qxj A: [96530]
    complexed with ni

Details for d1qxja_

PDB Entry: 1qxj (more details), 1.8 Å

PDB Description: Crystal structure of native phosphoglucose isomerase from Pyrococcus furiosus
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d1qxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxja_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

SCOPe Domain Coordinates for d1qxja_:

Click to download the PDB-style file with coordinates for d1qxja_.
(The format of our PDB-style files is described here.)

Timeline for d1qxja_: