Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins) automatically mapped to Pfam PF06560 |
Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species) Type II phosphoglucose isomerase |
Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries) Uniprot P83194 |
Domain d1qxja_: 1qxj A: [96530] complexed with ni |
PDB Entry: 1qxj (more details), 1.8 Å
SCOPe Domain Sequences for d1qxja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxja_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]} mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk vvdnprw
Timeline for d1qxja_: