SCOPe 2.02: Domain d1qxaa_: 1qxa A:

Lineage for d1qxaa_ (1qxa A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (1 family)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase B [101879] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)

8. Domain d1qxaa_: 1qxa A: [96518]
   complexed with etm

Details for d1qxaa_

PDB Entry: 1qxa, 2.5 Å

PDB Description: crystal structure of sortase b complexed with gly3

PDB Compounds: (A:) NPQTN specific sortase B

SCOPe Domain Sequences for d1qxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1qxaa_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
vtvkdrimtlstcedaysettkrivvvakiikvs

Timeline for d1qxaa_:

• d1qxaa_ first appeared in SCOP 1.67
  
• d1qxaa_ appears in SCOPe 2.01
  
• d1qxaa_ appears in SCOPe 2.03
  
• d1qxaa_ appears in the current release, SCOPe 2.08