Lineage for d1qxaa_ (1qxa A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382472Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 382473Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 382474Family b.100.1.1: Sortase [63818] (2 proteins)
  6. 382478Protein Sortase B [101879] (1 species)
  7. 382479Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)
  8. 382483Domain d1qxaa_: 1qxa A: [96518]
    complexed with etm

Details for d1qxaa_

PDB Entry: 1qxa (more details), 2.5 Å

PDB Description: crystal structure of sortase b complexed with gly3

SCOP Domain Sequences for d1qxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxaa_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus}
edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
vtvkdrimtlstcedaysettkrivvvakiikvs

SCOP Domain Coordinates for d1qxaa_:

Click to download the PDB-style file with coordinates for d1qxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1qxaa_: