Lineage for d1qxaa_ (1qxa A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820736Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2820737Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2820738Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 2820759Protein Sortase B [101879] (1 species)
  7. 2820760Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)
  8. 2820765Domain d1qxaa_: 1qxa A: [96518]
    complexed with etm

Details for d1qxaa_

PDB Entry: 1qxa (more details), 2.5 Å

PDB Description: crystal structure of sortase b complexed with gly3
PDB Compounds: (A:) NPQTN specific sortase B

SCOPe Domain Sequences for d1qxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxaa_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
vtvkdrimtlstcedaysettkrivvvakiikvs

SCOPe Domain Coordinates for d1qxaa_:

Click to download the PDB-style file with coordinates for d1qxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1qxaa_: