Class b: All beta proteins [48724] (178 folds) |
Fold b.100: Sortase [63816] (1 superfamily) barrel, closed; n=8, S=10; mixed sheet; two overside connections |
Superfamily b.100.1: Sortase [63817] (2 families) |
Family b.100.1.1: Sortase [63818] (3 proteins) |
Protein Sortase B [101879] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries) |
Domain d1qx6a_: 1qx6 A: [96516] complexed with e64 |
PDB Entry: 1qx6 (more details), 2.7 Å
SCOPe Domain Sequences for d1qx6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qx6a_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]} edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn vtvkdrimtlstcedaysettkrivvvakiikvs
Timeline for d1qx6a_: