Lineage for d1qx6a_ (1qx6 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333851Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 1333852Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 1333853Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 1333871Protein Sortase B [101879] (1 species)
  7. 1333872Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)
  8. 1333877Domain d1qx6a_: 1qx6 A: [96516]
    complexed with e64

Details for d1qx6a_

PDB Entry: 1qx6 (more details), 2.7 Å

PDB Description: Crystal structure of Sortase B complexed with E-64
PDB Compounds: (A:) NPQTN specific sortase B

SCOPe Domain Sequences for d1qx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx6a_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
vtvkdrimtlstcedaysettkrivvvakiikvs

SCOPe Domain Coordinates for d1qx6a_:

Click to download the PDB-style file with coordinates for d1qx6a_.
(The format of our PDB-style files is described here.)

Timeline for d1qx6a_: