SCOPe 2.03: Domain d1qx6a_: 1qx6 A:

Lineage for d1qx6a_ (1qx6 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (1 family)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase B [101879] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)

8. Domain d1qx6a_: 1qx6 A: [96516]
   complexed with e64

Details for d1qx6a_

PDB Entry: 1qx6, 2.7 Å

PDB Description: Crystal structure of Sortase B complexed with E-64

PDB Compounds: (A:) NPQTN specific sortase B

SCOPe Domain Sequences for d1qx6a_:

Sequence; same for both SEQRES and ATOM records:

>d1qx6a_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
vtvkdrimtlstcedaysettkrivvvakiikvs

Timeline for d1qx6a_:

• d1qx6a_ first appeared in SCOP 1.67
  
• d1qx6a_ appears in SCOPe 2.02
  
• d1qx6a_ appears in SCOPe 2.04
  
• d1qx6a_ appears in the current release, SCOPe 2.08