Lineage for d1qx1a2 (1qx1 A:523-1044)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664771Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 664772Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 664773Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (23 PDB entries)
  8. 664778Domain d1qx1a2: 1qx1 A:523-1044 [96513]
    Other proteins in same PDB: d1qx1a1, d1qx1a3
    complexed with fmf, mpd, nag, zn; mutant

Details for d1qx1a2

PDB Entry: 1qx1 (more details), 1.3 Å

PDB Description: golgi alpha-mannosidase ii d341n mutant complex with 2-f-mannosyl-f
PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d1qx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx1a2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOP Domain Coordinates for d1qx1a2:

Click to download the PDB-style file with coordinates for d1qx1a2.
(The format of our PDB-style files is described here.)

Timeline for d1qx1a2: