Lineage for d1qwza1 (1qwz A:31-244)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.100: Sortase [63816] (1 superfamily)
barrel, closed; n=8, S=10; mixed sheet; two overside connectionsSuperfamily b.100.1: Sortase [63817] (2 families) 
Family b.100.1.1: Sortase [63818] (3 proteins) 
Protein Sortase B [101879] (1 species) Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries) 
Domain d1qwza1: 1qwz A:31-244 [96510]
Other proteins in same PDB: d1qwza2
complexed with etm, ni, so4
Details for d1qwza1
PDB Entry: 1qwz (more details), 1.75 Å
PDB Description: Crystal structure of Sortase B from S. aureus complexed with MTSET
PDB Compounds: (A:) NPQTN specific sortase BSCOPe Domain Sequences for d1qwza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwza1 b.100.1.1 (A:31-244) Sortase B {Staphylococcus aureus [TaxId: 1280]}
edkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgk
tnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfy
ekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvn
vtvkdrimtlstcedaysettkrivvvakiikvs
SCOPe Domain Coordinates for d1qwza1:
Click to download the PDB-style file with coordinates for d1qwza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qwza1:
- d1qwza1 first appeared in SCOP 1.67, called d1qwza_
- d1qwza1 appears in SCOPe 2.06
- d1qwza1 appears in the current release, SCOPe 2.08
View in 3D
