Lineage for d1qwza_ (1qwz A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965576Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 965577Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 965578Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 965596Protein Sortase B [101879] (1 species)
  7. 965597Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)
  8. 965598Domain d1qwza_: 1qwz A: [96510]
    complexed with etm, ni, so4

Details for d1qwza_

PDB Entry: 1qwz (more details), 1.75 Å

PDB Description: Crystal structure of Sortase B from S. aureus complexed with MTSET
PDB Compounds: (A:) NPQTN specific sortase B

SCOPe Domain Sequences for d1qwza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwza_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]}
ghhhhhhhhhhssghisgdamedkqeranyeklqqkfqmlmskhqahvrpqfeslekink
divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyg
hhvgdntmfdvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfend
qdyqqfldetkrksvinsdvnvtvkdrimtlstcedaysettkrivvvakiikvs

SCOPe Domain Coordinates for d1qwza_:

Click to download the PDB-style file with coordinates for d1qwza_.
(The format of our PDB-style files is described here.)

Timeline for d1qwza_: