![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.100: Sortase [63816] (1 superfamily) barrel, closed; n=8, S=10; mixed sheet; two overside connections |
![]() | Superfamily b.100.1: Sortase [63817] (1 family) ![]() |
![]() | Family b.100.1.1: Sortase [63818] (3 proteins) |
![]() | Protein Sortase B [101879] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries) |
![]() | Domain d1qwza_: 1qwz A: [96510] complexed with etm, ni, so4 |
PDB Entry: 1qwz (more details), 1.75 Å
SCOP Domain Sequences for d1qwza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwza_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus [TaxId: 1280]} ghhhhhhhhhhssghisgdamedkqeranyeklqqkfqmlmskhqahvrpqfeslekink divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyg hhvgdntmfdvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfend qdyqqfldetkrksvinsdvnvtvkdrimtlstcedaysettkrivvvakiikvs
Timeline for d1qwza_: