SCOP 1.67: Domain d1qwza_: 1qwz A:

Lineage for d1qwza_ (1qwz A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (1 family)

5. Family b.100.1.1: Sortase [63818] (2 proteins)

6. Protein Sortase B [101879] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101880] (4 PDB entries)

8. Domain d1qwza_: 1qwz A: [96510]
   complexed with etm, ni, so4

Details for d1qwza_

PDB Entry: 1qwz, 1.75 Å

PDB Description: Crystal structure of Sortase B from S. aureus complexed with MTSET

SCOP Domain Sequences for d1qwza_:

Sequence; same for both SEQRES and ATOM records:

>d1qwza_ b.100.1.1 (A:) Sortase B {Staphylococcus aureus}
ghhhhhhhhhhssghisgdamedkqeranyeklqqkfqmlmskhqahvrpqfeslekink
divgwiklsgtslnypvlqgktnhdylnldferehrrkgsifmdfrnelknlnhntilyg
hhvgdntmfdvledylkqsfyekhkiiefdnkygkyqlqvfsayktttkdnyirtdfend
qdyqqfldetkrksvinsdvnvtvkdrimtlstcedaysettkrivvvakiikvs

Timeline for d1qwza_:

• d1qwza_ is new in SCOP 1.67
  
• d1qwza_ appears in SCOP 1.69
  
• d1qwza_ appears in the current release, SCOPe 2.08, called d1qwza1