Lineage for d1qwya_ (1qwy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072281Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 2072309Family b.84.3.2: Peptidoglycan hydrolase LytM [102006] (1 protein)
    Peptidase family M23; contains extra N-terminal, non-conserved beta-sheet subdomain
  6. 2072310Protein Peptidoglycan hydrolase LytM [102007] (1 species)
  7. 2072311Species Staphylococcus aureus [TaxId:1280] [102008] (1 PDB entry)
  8. 2072312Domain d1qwya_: 1qwy A: [96509]
    complexed with zn

Details for d1qwya_

PDB Entry: 1qwy (more details), 1.3 Å

PDB Description: Latent LytM at 1.3 A resolution
PDB Compounds: (A:) peptidoglycan hydrolase

SCOPe Domain Sequences for d1qwya_:

Sequence, based on SEQRES records: (download)

>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]}
vsygtyytidsngdyhhtpdgnwnqamfdnkeysytfvdaqghthyfyncypknanangs
gqtyvnpatagdnndytasqsqqhinqygyqsnvgpdasyyshsnnnqaynshdgngkvn
ypngtsnqnggsaskatasghakdaswltsrkqlqpygqyhgggahygvdyampenspvy
sltdgtvvqagwsnygggnqvtikeansnnyqwymhnnrltvsagdkvkagdqiaysgst
gnstaphvhfqrmsggignqyavdptsylq

Sequence, based on observed residues (ATOM records): (download)

>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]}
vsygtyytidsngdyhhtpdgnwnqamfdnkeysytfvdaqghthyfyncypknanangs
gqtyvnpatagdnndytasqsqqhinqygyqsnvgpdasyyssghakdaswltsrkqlqp
ygqyhgggahygvdyampenspvysltdgtvvqagwsnygggnqvtikeansnnyqwymh
nnrltvsagdkvkagdqiaysgstgnstaphvhfqrmsggignqyavdptsylq

SCOPe Domain Coordinates for d1qwya_:

Click to download the PDB-style file with coordinates for d1qwya_.
(The format of our PDB-style files is described here.)

Timeline for d1qwya_: