![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) ![]() |
![]() | Family b.61.2.2: Staphostatin [101869] (2 proteins) cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand |
![]() | Protein Staphostatin B (SspC) [101872] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries) |
![]() | Domain d1qwxb_: 1qwx B: [96508] |
PDB Entry: 1qwx (more details), 1.5 Å
SCOPe Domain Sequences for d1qwxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwxb_ b.61.2.2 (B:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]} myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerl
Timeline for d1qwxb_: