SCOPe 2.08: Domain d1qwxb_: 1qwx B:

Lineage for d1qwxb_ (1qwx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families)

5. Family b.61.2.2: Staphostatin [101869] (2 proteins)
   cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand

6. Protein Staphostatin B (SspC) [101872] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)

8. Domain d1qwxb_: 1qwx B: [96508]

Details for d1qwxb_

PDB Entry: 1qwx, 1.5 Å

PDB Description: Crystal Structure of a Staphylococcal Inhibitor/Chaperone

PDB Compounds: (B:) Cysteine protease

SCOPe Domain Sequences for d1qwxb_:

Sequence; same for both SEQRES and ATOM records:

>d1qwxb_ b.61.2.2 (B:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerl

Timeline for d1qwxb_:

• d1qwxb_ first appeared in SCOP 1.67
  
• d1qwxb_ appears in SCOPe 2.07