Lineage for d1qwxa_ (1qwx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806532Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) (S)
  5. 2806539Family b.61.2.2: Staphostatin [101869] (2 proteins)
    cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand
  6. 2806543Protein Staphostatin B (SspC) [101872] (1 species)
  7. 2806544Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)
  8. 2806547Domain d1qwxa_: 1qwx A: [96507]

Details for d1qwxa_

PDB Entry: 1qwx (more details), 1.5 Å

PDB Description: Crystal Structure of a Staphylococcal Inhibitor/Chaperone
PDB Compounds: (A:) Cysteine protease

SCOPe Domain Sequences for d1qwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwxa_ b.61.2.2 (A:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfmgnwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssidneeiiyildyddtqhilmqtsskqgigtsrpivyerl

SCOPe Domain Coordinates for d1qwxa_:

Click to download the PDB-style file with coordinates for d1qwxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qwxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qwxb_