SCOPe 2.05: Domain d1qwua3: 1qwu A:31-411

Lineage for d1qwua3 (1qwu A:31-411)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88715] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d1qwua3: 1qwu A:31-411 [96505]
   Other proteins in same PDB: d1qwua1, d1qwua2
   complexed with gul, mpd, nag, zn; mutant

Details for d1qwua3

PDB Entry: 1qwu, 2.03 Å

PDB Description: golgi alpha-mannosidase ii d341n mutant complex with 5-f-guloside

PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d1qwua3:

Sequence; same for both SEQRES and ATOM records:

>d1qwua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgdnfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

Timeline for d1qwua3:

• d1qwua3 first appeared in SCOP 1.67
  
• d1qwua3 appears in SCOPe 2.04
  
• d1qwua3 appears in SCOPe 2.06
  
• d1qwua3 appears in the current release, SCOPe 2.08